LGALS8 Antikörper

Produktnummer ABIN630814

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LGALS8 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für LGALS8 Antikörper (ABIN630814)

Target: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LGALS8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LGALS8 Antikörper

Aufreinigung: Affinity purified

Immunogen: LGALS8 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LGALS8 Blocking Peptide, (ABIN938400), is also available for use as a blocking control in assays to test for specificity of this LGALS8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LGALS8

Target: LGALS8 (Lectin, Galactoside-Binding, Soluble, 8 (LGALS8))

Andere Bezeichnung: LGALS8

Hintergrund: LGALS8 is a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions.

Molekulargewicht: 39 kDa (MW of target protein)