PRKX Antikörper (N-Term)

Produktnummer ABIN630810

Produktdetails anti-PRKX Antikörper

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKX antibody was raised against the N terminal of PRKX

Aufreinigung: Affinity purified

Immunogen: PRKX antibody was raised using the N terminal of PRKX corresponding to a region with amino acids MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKX Blocking Peptide, catalog no. 33R-5894, is also available for use as a blocking control in assays to test for specificity of this PRKX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKX

Target: PRKX (Protein Kinase, X-Linked (PRKX))

Andere Bezeichnung: PRKX (PRKX Produkte)

Synonyme: PKX1 antikoerper, Pkare antikoerper, protein kinase, X-linked antikoerper, PRKX antikoerper, Prkx antikoerper

Hintergrund: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis