DTX2 Antikörper

Produktnummer ABIN630801

Dieses Anti-DTX2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von DTX2 in WB. Geeignet für Human, Hund und Zebrafisch (Danio rerio).

Kurzübersicht für DTX2 Antikörper (ABIN630801)

Target: DTX2 (Deltex Homolog 2 (DTX2))

Reaktivität: Human, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DTX2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DTX2 Antikörper

Aufreinigung: Affinity purified

Immunogen: DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DTX2 Blocking Peptide, (ABIN937691), is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTX2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DTX2

Target: DTX2 (Deltex Homolog 2 (DTX2))

Andere Bezeichnung: DTX2

Hintergrund: DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Molekulargewicht: 62 kDa (MW of target protein)

Pathways: Notch Signalweg