Keratin 10 Antikörper
-
- Target Alle Keratin 10 (KRT10) Antikörper anzeigen
- Keratin 10 (KRT10)
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Keratin 10 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Cytokeratin 10 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD
- Top Product
- Discover our top product KRT10 Primärantikörper
-
anti-Keratin 10 (KRT10) (AA 153-456) antibody
KRT10 Reaktivität: Human WB, IHC (p), ELISA, ICC, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio) IHC, WB, FACS, ICC, IHC (fro) Wirt: Maus Monoclonal RKSE60 unconjugated
anti-Keratin 10 (KRT10) (AA 345-454) antibodyKRT10 Reaktivität: Human, Maus, Ratte, Affe IHC, WB, FACS, ELISA, ICC Wirt: Maus Monoclonal 3C2F5 unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human WB, IF Wirt: Kaninchen Monoclonal unconjugated
anti-Keratin 10 (KRT10) (AA 318-346) antibodyKRT10 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18413 unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human, Maus, Ratte, Hund, Schwein IHC, WB, FACS, ICC, IHC (fro) Wirt: Maus Monoclonal RKSE60 unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human IHC (p), ICC, IP Wirt: Maus Monoclonal VIK-10 unconjugated
anti-Keratin 10 (KRT10) (AA 150-179), (N-Term) antibodyKRT10 Reaktivität: Human WB, FACS, IHC (p) Wirt: Kaninchen Polyclonal RB18412 unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human, Maus, Ratte WB, IHC (p), IF (cc) Wirt: Kaninchen Monoclonal 1D8 unconjugated
anti-Keratin 10 (KRT10) antibodyKRT10 Reaktivität: Human, Maus IHC, WB, StM Wirt: Maus Monoclonal LH2 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cytokeratin 10 Blocking Peptide, catalog no. 33R-2526, is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 10 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT10 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Keratin 10 (KRT10)
- Andere Bezeichnung
- Cytokeratin 10 (KRT10 Produkte)
- Synonyme
- BCIE antikoerper, BIE antikoerper, CK10 antikoerper, EHK antikoerper, K10 antikoerper, KPP antikoerper, D130054E02Rik antikoerper, K1C1 antikoerper, Krt-1.10 antikoerper, Krt1-10 antikoerper, Ka10 antikoerper, Ker10 antikoerper, KRT10 antikoerper, KRT25 antikoerper, KRT27 antikoerper, KRT28 antikoerper, keratin 10 antikoerper, keratin 10, type I S homeolog antikoerper, keratin, type I cytoskeletal 25 antikoerper, KRT10 antikoerper, Krt10 antikoerper, krt10.S antikoerper, LOC101085587 antikoerper
- Hintergrund
- KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.
- Molekulargewicht
- 59 kDa (MW of target protein)
-
