Keratin 10 Antikörper

Produktnummer ABIN630798

Dieses Anti-Keratin 10-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Keratin 10 in WB. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für Keratin 10 Antikörper (ABIN630798)

Target: Keratin 10 (KRT10)

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Keratin 10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Keratin 10 Antikörper

Aufreinigung: Affinity purified

Immunogen: Cytokeratin 10 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKHGNSHQGEPRD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cytokeratin 10 Blocking Peptide, (ABIN937912), is also available for use as a blocking control in assays to test for specificity of this Cytokeratin 10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KRT10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Keratin 10

Target: Keratin 10 (KRT10)

Andere Bezeichnung: Cytokeratin 10

Hintergrund: KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis.

Molekulargewicht: 59 kDa (MW of target protein)