TRIM45 Antikörper (N-Term)
Kurzübersicht für TRIM45 Antikörper (N-Term) (ABIN630795)
Target
Alle TRIM45 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- TRIM45 antibody was raised against the N terminal of TRIM45
-
Aufreinigung
- Affinity purified
-
Immunogen
- TRIM45 antibody was raised using the N terminal of TRIM45 corresponding to a region with amino acids FKAPRLLPCLHTVCTTCLEQLEPFSVVDIRGGDSDTSSEGSIFQELKPRS
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
TRIM45 Blocking Peptide, (ABIN938327), is also available for use as a blocking control in assays to test for specificity of this TRIM45 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM45 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- TRIM45 (Tripartite Motif Containing 45 (TRIM45))
-
Andere Bezeichnung
- TRIM45
-
Hintergrund
- TRIM45 is a member of the tripartite motif family. It may function as a transcriptional repressor of the mitogen-activated protein kinase pathway. Alternatively spliced transcript variants have been described.
-
Molekulargewicht
- 64 kDa (MW of target protein)
Target
-