SULT1C2 Antikörper (C-Term)

Produktnummer ABIN630789

Produktdetails anti-SULT1C2 Antikörper

Target: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT1C2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT1 C2 antibody was raised against the C terminal of SULT1 2

Aufreinigung: Affinity purified

Immunogen: SULT1 C2 antibody was raised using the C terminal of SULT1 2 corresponding to a region with amino acids LDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT1C2 Blocking Peptide, catalog no. 33R-4859, is also available for use as a blocking control in assays to test for specificity of this SULT1C2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT1C2

Target: SULT1C2 (Sulfotransferase Family, Cytosolic, 1C, Member 2 (SULT1C2))

Andere Bezeichnung: SULT1C2 (SULT1C2 Produkte)

Synonyme: ST1C1 antikoerper, ST1C2 antikoerper, SULT1C1 antikoerper, humSULTC2 antikoerper, 1810008N17Rik antikoerper, Sult1c1 antikoerper, st1c1 antikoerper, st1c2 antikoerper, sult1c1 antikoerper, MGC88979 antikoerper, SULT1C2 antikoerper, Sult1c2 antikoerper, sulfotransferase family 1C member 2 antikoerper, sulfotransferase family, cytosolic, 1C, member 2 antikoerper, sulfotransferase family 1C member 2 S homeolog antikoerper, sulfotransferase 1C2 antikoerper, SULT1C2 antikoerper, Sult1c2 antikoerper, sult1c2 antikoerper, sult1c2.S antikoerper, LOC100060302 antikoerper, LOC100729651 antikoerper, LOC100623541 antikoerper

Hintergrund: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. SULT1C2 is a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds.

Molekulargewicht: 35 kDa (MW of target protein)