Septin 9 Antikörper (C-Term)

Produktnummer ABIN630783

Der Kaninchen Polyklonal anti-Septin 9 Antikörper (ABIN630783) detektiert spezifisch Septin 9 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Septin 9 Antikörper (C-Term) (ABIN630783)

Target: Septin 9 (SEPT9)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Septin 9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Septin 9 Antikörper

Bindungsspezifität: C-Term

Spezifität: Septin 9 antibody was raised against the C terminal of 40430

Aufreinigung: Affinity purified

Immunogen: Septin 9 antibody was raised using the C terminal of 40430 corresponding to a region with amino acids HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 40057 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Septin 9

Target: Septin 9 (SEPT9)

Andere Bezeichnung: Septin 9

Hintergrund: Septin-9 is a member of the septin family, which contains cytoplasmic cytoskeletal filament-forming proteins that have a conserved GTP-binding domain.

Molekulargewicht: 37 kDa (MW of target protein)