ALDOB Antikörper (Middle Region)

Produktnummer ABIN630782

Produktdetails anti-ALDOB Antikörper

Target: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDOB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALDOB antibody was raised against the middle region of ALDOB

Aufreinigung: Affinity purified

Immunogen: ALDOB antibody was raised using the middle region of ALDOB corresponding to a region with amino acids KLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDOB Blocking Peptide, catalog no. 33R-4503, is also available for use as a blocking control in assays to test for specificity of this ALDOB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDOB

Target: ALDOB (Aldolase B, Fructose-Bisphosphate (ALDOB))

Andere Bezeichnung: ALDOB (ALDOB Produkte)

Synonyme: aldb antikoerper, aldo2 antikoerper, xaldb antikoerper, ALDOB antikoerper, aldob antikoerper, ALDB antikoerper, ALDO2 antikoerper, Aldo-2 antikoerper, Aldo2 antikoerper, BC016435 antikoerper, LIV10 antikoerper, fb25f09 antikoerper, wu:fb25f09 antikoerper, aldolase B antikoerper, aldolase, fructose-bisphosphate B antikoerper, aldolase, fructose-bisphosphate B S homeolog antikoerper, aldolase b, fructose-bisphosphate antikoerper, aldolase B, fructose-bisphosphate antikoerper, xaldb antikoerper, aldob antikoerper, aldob.S antikoerper, ALDOB antikoerper, Aldob antikoerper

Hintergrund: Fructose-1,6-bisphosphate aldolase (EC 4.1.2.13) is a tetrameric glycolytic enzyme that catalyzes the reversible conversion of fructose-1,6-bisphosphate to glyceraldehyde 3-phosphate and dihydroxyacetone phosphate. Vertebrates have 3 aldolase isozymes which are distinguished by their electrophoretic and catalytic properties. Differences indicate that aldolases A, B, and C are distinct proteins, the products of a family of related 'housekeeping' genes exhibiting developmentally regulated expression of the different isozymes. The developing embryo produces aldolase A, which is produced in even greater amounts in adult muscle where it can be as much as 5% of total cellular protein. In adult liver, kidney and intestine, aldolase A expression is repressed and aldolase B is produced. In brain and other nervous tissue, aldolase A and C are expressed about equally. There is a high degree of homology between aldolase A and C. Defects in ALDOB cause hereditary fructose intolerance.

Molekulargewicht: 39 kDa (MW of target protein)