APPBP2 Antikörper

Produktnummer ABIN630772

Produktdetails anti-APPBP2 Antikörper

Target: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APPBP2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: APPBP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYLLN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

APPBP2 Blocking Peptide, catalog no. 33R-7479, is also available for use as a blocking control in assays to test for specificity of this APPBP2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPBP2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APPBP2

Target: APPBP2 (Amyloid beta Precursor Protein (Cytoplasmic Tail) Binding Protein 2 (APPBP2))

Andere Bezeichnung: APPBP2 (APPBP2 Produkte)

Synonyme: HS.84084 antikoerper, PAT1 antikoerper, 1300003O07Rik antikoerper, AI465480 antikoerper, zgc:76971 antikoerper, wu:fb78e11 antikoerper, wu:fc25c09 antikoerper, APPBP2 antikoerper, DKFZp459F0530 antikoerper, amyloid beta precursor protein binding protein 2 antikoerper, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 antikoerper, amyloid beta precursor protein (cytoplasmic tail) binding protein 2 S homeolog antikoerper, APPBP2 antikoerper, Appbp2 antikoerper, appbp2 antikoerper, appbp2.S antikoerper

Hintergrund: APPBP2 interacts with microtubules and is functionally associated with beta-amyloid precursor protein transport and/or processing. The beta-amyloid precursor protein is a cell surface protein with signal-transducing properties, and it is thought to play a role in the pathogenesis of Alzheimer's disease. APPBP2 has been found to be highly expressed in breast cancer.

Molekulargewicht: 67 kDa (MW of target protein)