Homeotic Protein Proboscipedia Antikörper (Middle Region)
Kurzübersicht für Homeotic Protein Proboscipedia Antikörper (Middle Region) (ABIN630765)
Target
Reaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- Middle Region
-
Spezifität
- PB antibody was raised against the middle region of Pb
-
Aufreinigung
- Affinity purified
-
Immunogen
- PB antibody was raised using the middle region of Pb corresponding to a region with amino acids DLTERQVKVWFQNRRMKHKRQTLSKTDDEDNKDSLKGDDDQSDSNSNSKK
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PB Blocking Peptide, (ABIN937453), is also available for use as a blocking control in assays to test for specificity of this PB antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PB antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- Homeotic Protein Proboscipedia (PB)
-
Andere Bezeichnung
- PB
-
Hintergrund
- Pb is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It controls development of mouthparts, and labial and maxillary palps.
-
Molekulargewicht
- 83 kDa (MW of target protein)
Target
-