HOXA7 Antikörper (C-Term)
-
- Target Alle HOXA7 Antikörper anzeigen
- HOXA7 (Homeobox A7 (HOXA7))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HOXA7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ANTP antibody was raised against the C terminal Of Antp
- Aufreinigung
- Affinity purified
- Immunogen
- ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH
- Top Product
- Discover our top product HOXA7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HOXA7 (Homeobox A7 (HOXA7))
- Andere Bezeichnung
- ANTP (HOXA7 Produkte)
- Synonyme
- ANTP antikoerper, HOX1 antikoerper, HOX1.1 antikoerper, HOX1A antikoerper, AV118143 antikoerper, Hox-1.1 antikoerper, HOXA-7 antikoerper, Hox-A7 antikoerper, antp antikoerper, hox36 antikoerper, HOXA7 antikoerper, Hox1r5 antikoerper, Hoxa7 antikoerper, hox1 antikoerper, hox1a antikoerper, hox1.1 antikoerper, Xhox-36 antikoerper, XlHbox-3 antikoerper, homeobox A7 antikoerper, homeobox A7 L homeolog antikoerper, HOXA7 antikoerper, Hoxa7 antikoerper, hoxa7.L antikoerper, hoxa7 antikoerper
- Hintergrund
- Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.
- Molekulargewicht
- 33 kDa (MW of target protein)
-