HOXA7 Antikörper (C-Term)

Produktnummer ABIN630763

Produktdetails anti-HOXA7 Antikörper

Target: HOXA7 (Homeobox A7 (HOXA7))

Bindungsspezifität: C-Term

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HOXA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANTP antibody was raised against the C terminal Of Antp

Aufreinigung: Affinity purified

Immunogen: ANTP antibody was raised using the C terminal Of Antp corresponding to a region with amino acids QQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANTP Blocking Peptide, catalog no. 33R-7700, is also available for use as a blocking control in assays to test for specificity of this ANTP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HOXA7

Target: HOXA7 (Homeobox A7 (HOXA7))

Andere Bezeichnung: ANTP (HOXA7 Produkte)

Hintergrund: Antp is a sequence-specific transcription factor which is part of a developmental regulatory system that regulates segmental identity in the mesothorax. It provides cells with specific positional identities on the anterior-posterior axis.

Molekulargewicht: 33 kDa (MW of target protein)