Chromosome 5 Open Reading Frame 39 (C5orf39) (N-Term) Antikörper

Produktnummer ABIN630761

Produktdetails

Target: Chromosome 5 Open Reading Frame 39 (C5orf39)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C5 ORF39 antibody was raised against the N terminal Of C5 rf39

Aufreinigung: Affinity purified

Immunogen: C5 ORF39 antibody was raised using the N terminal Of C5 rf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C5ORF39 Blocking Peptide, catalog no. 33R-2665, is also available for use as a blocking control in assays to test for specificity of this C5ORF39 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF39 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: Chromosome 5 Open Reading Frame 39 (C5orf39)

Andere Bezeichnung: C5ORF39 (C5orf39 Produkte)

Synonyme: AX2R antikoerper, AXIIR antikoerper, C5orf39 antikoerper, annexin A2 receptor antikoerper, ANXA2R antikoerper

Hintergrund: C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

Molekulargewicht: 22 kDa (MW of target protein)