RAP1GAP Antikörper (Middle Region)

Produktnummer ABIN630756

Der Kaninchen Polyklonal anti-RAP1GAP Antikörper (ABIN630756) detektiert spezifisch RAP1GAP in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für RAP1GAP Antikörper (Middle Region) (ABIN630756)

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAP1GAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RAP1GAP Antikörper

Bindungsspezifität: Middle Region

Spezifität: RAP1 GAP antibody was raised against the middle region of RAP1 AP

Aufreinigung: Affinity purified

Immunogen: RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAP1GAP Blocking Peptide, (ABIN939334), is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAP1GAP

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Andere Bezeichnung: RAP1GAP

Hintergrund: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Molekulargewicht: 73 kDa (MW of target protein)