RAP1GAP Antikörper (Middle Region)

Produktnummer ABIN630756

Produktdetails anti-RAP1GAP Antikörper

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RAP1GAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RAP1 GAP antibody was raised against the middle region of RAP1 AP

Aufreinigung: Affinity purified

Immunogen: RAP1 GAP antibody was raised using the middle region of RAP1 AP corresponding to a region with amino acids IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RAP1GAP Blocking Peptide, catalog no. 33R-3948, is also available for use as a blocking control in assays to test for specificity of this RAP1GAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAP0 AP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RAP1GAP

Target: RAP1GAP (RAP1 GTPase Activating Protein (RAP1GAP))

Andere Bezeichnung: RAP1GAP (RAP1GAP Produkte)

Synonyme: RAP1GA1 antikoerper, RAP1GAP1 antikoerper, RAP1GAPII antikoerper, RAPGAP antikoerper, 1300019I11Rik antikoerper, 2310004O14Rik antikoerper, AI427470 antikoerper, Rap1ga1 antikoerper, RAP1 antikoerper, RAP1GAP antikoerper, rap1ga1 antikoerper, rap1gap1 antikoerper, rap1gapii antikoerper, rapgap antikoerper, zgc:175180 antikoerper, DKFZp459A114 antikoerper, RAP1 GTPase activating protein antikoerper, Rap1 GTPase-activating protein antikoerper, RAP1 GTPase activating protein 1 antikoerper, RAP1 GTPase activating protein L homeolog antikoerper, Rap1 GTPase-activating protein 1 antikoerper, si:dkey-166d12.2 antikoerper, RAP1GAP antikoerper, Rap1gap antikoerper, RAP1GAP1 antikoerper, rap1gap.L antikoerper, Tsp_09520 antikoerper, rap1gap antikoerper, si:dkey-166d12.2 antikoerper

Hintergrund: RAP1GAP is the GTPase activator for the nuclear Ras-related regulatory protein RAP-1A (KREV-1), converting it to the putatively inactive GDP-bound state.

Molekulargewicht: 73 kDa (MW of target protein)