HCFC1R1 Antikörper

Produktnummer ABIN630754

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch HCFC1R1 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für HCFC1R1 Antikörper (ABIN630754)

Target: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HCFC1R1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HCFC1R1 Antikörper

Aufreinigung: Affinity purified

Immunogen: HCFC1 R1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRGAVPMSTKRRLEEEQEPLRKQFLSEENMATHFSQLSLHNDHPYCSPPM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HCFC1R1 Blocking Peptide, (ABIN5613945), is also available for use as a blocking control in assays to test for specificity of this HCFC1R1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HCFC0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HCFC1R1

Target: HCFC1R1 (Host Cell Factor C1 Regulator 1 (XPO1 Dependent) (HCFC1R1))

Andere Bezeichnung: HCFC1R1

Hintergrund: HCFC1R1 regulates HCFC1 activity by modulating its subcellular localization. Overexpression of HCFC1R1 leads to accumulation of HCFC1 in the cytoplasm. HCFC1R1-mediated export may provide the pool of cytoplasmic HCFC1 required for import of virion-derived VP16 into the nucleus.

Molekulargewicht: 15 kDa (MW of target protein)