RPL30 Antikörper (Middle Region)

Produktnummer ABIN630753

Produktdetails anti-RPL30 Antikörper

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPL30 antibody was raised against the middle region of RPL30

Aufreinigung: Affinity purified

Immunogen: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL30 Blocking Peptide, catalog no. 33R-6177, is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL30

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Andere Bezeichnung: RPL30 (RPL30 Produkte)

Synonyme: BcDNA:RE25263 antikoerper, BcDNA:RH09938 antikoerper, CG10652 antikoerper, Dmel\\CG10652 antikoerper, L30 antikoerper, RPL30 antikoerper, Rp L30 antikoerper, Rpl30 antikoerper, anon-EST:fe1D4 antikoerper, l(2)01265 antikoerper, l(2)SH0229 antikoerper, l(2)SH2 0229 antikoerper, l(2)k09918 antikoerper, plume antikoerper, fa93d05 antikoerper, wu:fa93d05 antikoerper, zgc:56640 antikoerper, zgc:77683 antikoerper, Ribosomal protein L30 antikoerper, ribosomal protein L30 antikoerper, ribosomal protein L30E antikoerper, Ribosomal protein L30, component of cytosolic 80S ribosome and 60S large subunit antikoerper, 50S ribosomal protein L30 antikoerper, ribosomal protein L24 antikoerper, ribosomal protein L30 S homeolog antikoerper, 60S ribosomal protein L30 antikoerper, RpL30 antikoerper, RPL30 antikoerper, rpl30 antikoerper, HVO_RS16975 antikoerper, RPL24 antikoerper, Rpl30 antikoerper, rpl30.S antikoerper, LOC101106855 antikoerper

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Molekulargewicht: 13 kDa (MW of target protein)