RPL30 Antikörper (Middle Region)

Produktnummer ABIN630753

Dieses Anti-RPL30-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von RPL30 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für RPL30 Antikörper (Middle Region) (ABIN630753)

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPL30 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPL30 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPL30 antibody was raised against the middle region of RPL30

Aufreinigung: Affinity purified

Immunogen: RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids MLAKTGVHHYSGNNIELGTACGKYYRVCTLAIIDPGDSDIIRSMPEQTGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPL30 Blocking Peptide, (ABIN5615939), is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPL30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPL30

Target: RPL30 (Ribosomal Protein L30 (RPL30))

Andere Bezeichnung: RPL30

Hintergrund: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

Molekulargewicht: 13 kDa (MW of target protein)