NUP43 Antikörper (Middle Region)

Produktnummer ABIN630751

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch NUP43 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für NUP43 Antikörper (Middle Region) (ABIN630751)

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NUP43 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NUP43 antibody was raised against the middle region of NUP43

Aufreinigung: Affinity purified

Immunogen: NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP43 Blocking Peptide, (ABIN939216), is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP43

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Andere Bezeichnung: NUP43

Hintergrund: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Molekulargewicht: 42 kDa (MW of target protein)