NUP43 Antikörper (Middle Region)

Produktnummer ABIN630751

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch NUP43 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für NUP43 Antikörper (Middle Region) (ABIN630751)

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP43 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NUP43 Antikörper

Bindungsspezifität: Middle Region

Spezifität: NUP43 antibody was raised against the middle region of NUP43

Aufreinigung: Affinity purified

Immunogen: NUP43 antibody was raised using the middle region of NUP43 corresponding to a region with amino acids HQSVISSWLSTDPAKDRIEITSLLPSRSLSVNTLDVLGPCLVCGTDAEAI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP43 Blocking Peptide, (ABIN939216), is also available for use as a blocking control in assays to test for specificity of this NUP43 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP43 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP43

Target: NUP43 (Nucleoporin 43kDa (NUP43))

Andere Bezeichnung: NUP43

Hintergrund: NUP43 is the component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation.

Molekulargewicht: 42 kDa (MW of target protein)