CENPP Antikörper (N-Term)

Produktnummer ABIN630748

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch CENPP in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für CENPP Antikörper (N-Term) (ABIN630748)

Target: CENPP (Centromere Protein P (CENPP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CENPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CENPP Antikörper

Bindungsspezifität: N-Term

Spezifität: CENPP antibody was raised against the N terminal of CENPP

Aufreinigung: Affinity purified

Immunogen: CENPP antibody was raised using the N terminal of CENPP corresponding to a region with amino acids VQKSFQAIHQFNLEGWKSSKDLKNQLGHLESELSFLSTLTGINIRNHSKQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CENPP Blocking Peptide, (ABIN5612821), is also available for use as a blocking control in assays to test for specificity of this CENPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CENPP

Target: CENPP (Centromere Protein P (CENPP))

Andere Bezeichnung: CENPP

Hintergrund: CENPP is the component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. CENPP may be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Molekulargewicht: 33 kDa (MW of target protein)