GGN Antikörper (N-Term)

Produktnummer ABIN630747

Dieses Anti-GGN-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von GGN in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für GGN Antikörper (N-Term) (ABIN630747)

Target: GGN (Gametogenetin (GGN))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GGN Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GGN Antikörper

Bindungsspezifität: N-Term

Spezifität: GGN antibody was raised against the N terminal of GGN

Aufreinigung: Affinity purified

Immunogen: GGN antibody was raised using the N terminal of GGN corresponding to a region with amino acids GPSKWQKPAGTPVPRIRRLLEASHRGQGDPPSLRPLKPPPPPRQLSVKDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GGN Blocking Peptide, (ABIN938870), is also available for use as a blocking control in assays to test for specificity of this GGN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GGN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GGN

Target: GGN (Gametogenetin (GGN))

Andere Bezeichnung: GGN

Hintergrund: GGN may be involved in spermatogenesis.

Molekulargewicht: 67 kDa (MW of target protein)