NUP35 Antikörper (C-Term)

Produktnummer ABIN630746

Produktdetails anti-NUP35 Antikörper

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NUP35 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NUP35 antibody was raised against the C terminal of NUP35

Aufreinigung: Affinity purified

Immunogen: NUP35 antibody was raised using the C terminal of NUP35 corresponding to a region with amino acids STPRISTMRPLATAYKASTSDYQVISDRQTPKKDESLVSKAMEYMFGW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NUP35 Blocking Peptide, catalog no. 33R-8881, is also available for use as a blocking control in assays to test for specificity of this NUP35 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NUP35 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NUP35

Target: NUP35 (Nucleoporin 35kDa (NUP35))

Andere Bezeichnung: NUP35 (NUP35 Produkte)

Synonyme: MGC64281 antikoerper, nup53 antikoerper, 2310006I24Rik antikoerper, 35kDa antikoerper, 5330402E05Rik antikoerper, MP44 antikoerper, NO44 antikoerper, fj68d11 antikoerper, wu:fj68d11 antikoerper, zgc:65979 antikoerper, NP44 antikoerper, NUP53 antikoerper, nucleoporin 35kDa L homeolog antikoerper, nucleoporin 35 antikoerper, nucleoporin 35kDa antikoerper, nucleoporin NUP53 antikoerper, nup35.L antikoerper, NUP35 antikoerper, nup35 antikoerper, CpipJ_CPIJ009421 antikoerper, Nup35 antikoerper

Hintergrund: NUP35 is a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC. This gene encodes a member of the nucleoporin family. The protein is localized to the nuclear rim and is part of the nuclear pore complex (NPC). All molecules entering or leaving the nucleus either diffuse through or are actively transported by the NPC.

Molekulargewicht: 35 kDa (MW of target protein)