ALG1L3P Antikörper (C-Term)

Produktnummer ABIN630743

Produktdetails anti-ALG1L3P Antikörper

Target: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG1L3P Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LOC650515 antibody was raised against the C terminal of LOC650515

Aufreinigung: Affinity purified

Immunogen: LOC650515 antibody was raised using the C terminal of LOC650515 corresponding to a region with amino acids VQTVLPLVMDTELLGQRLKPQGPCCPSRSFFSESQGKSFRVAPPSGQKLI

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC650515 Blocking Peptide, catalog no. 33R-9764, is also available for use as a blocking control in assays to test for specificity of this LOC650515 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC650515 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG1L3P

Target: ALG1L3P (Asparagine-Linked Glycosylation 1-Like 3, Pseudogene (ALG1L3P))

Abstract: ALG1L3P Produkte

Synonyme: asparagine-linked glycosylation 1-like 3, pseudogene antikoerper, ALG1L3P antikoerper

Hintergrund: The sequence of LOC650515 is derived from an annotated genomic sequence (NW_922073) using gene prediction method: GNOMON, supported by EST evidence. The exact function of LOC650515 remains unknown.

Molekulargewicht: 39 kDa (MW of target protein)