FAD Synthetase Antikörper

Produktnummer ABIN630740

Produktdetails anti-FAD Synthetase Antikörper

Target: FAD Synthetase

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAD Synthetase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLAD1 Blocking Peptide, catalog no. 33R-7130, is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLAD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAD Synthetase

Target: FAD Synthetase

Andere Bezeichnung: FLAD1 (FAD Synthetase Produkte)

Synonyme: wu:fa92c06 antikoerper, zgc:91843 antikoerper, fad1 antikoerper, fads antikoerper, pp591 antikoerper, FAD1 antikoerper, FADS antikoerper, RP11-307C12.7 antikoerper, A930017E24Rik antikoerper, Pp591 antikoerper, FAD synthetase (predicted) antikoerper, FAD synthetase antikoerper, flavin adenine dinucleotide synthetase 1 antikoerper, flavin adenine dinucleotide synthetase 1 L homeolog antikoerper, SPCC1235.04c antikoerper, GY4MC1_1590 antikoerper, SpiBuddy_1392 antikoerper, Psed_2275 antikoerper, Spico_0597 antikoerper, Trebr_1967 antikoerper, Geoth_1673 antikoerper, Ccan_14090 antikoerper, flad1 antikoerper, FLAD1 antikoerper, flad1.L antikoerper, Flad1 antikoerper

Hintergrund: FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

Molekulargewicht: 65 kDa (MW of target protein)