PARP6 Antikörper

Produktnummer ABIN630726

Dieses Anti-PARP6-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von PARP6 in WB und IHC. Geeignet für Human, Maus, Ratte und Hund.

Kurzübersicht für PARP6 Antikörper (ABIN630726)

Target: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PARP6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PARP6 Antikörper

Aufreinigung: Affinity purified

Immunogen: PARP6 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLPLSRLKFMHTSHQFLLLSSPPAKEARFRTAKKLYGSTFAFHGSHIENW

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PARP6 Blocking Peptide, (ABIN939914), is also available for use as a blocking control in assays to test for specificity of this PARP6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARP6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PARP6

Target: PARP6 (Poly (ADP-Ribose) Polymerase Family, Member 6 (PARP6))

Andere Bezeichnung: PARP6

Hintergrund: Poly(ADP-ribose) polymerases (PARPs) constitute a large family of 18 proteins, encoded by different genes and displaying a conserved catalytic domain. They are involved in DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells.

Molekulargewicht: 59 kDa (MW of target protein)