CEP55 Antikörper (N-Term)

Produktnummer ABIN630721

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch CEP55 in WB. Es zeigt Reaktivität gegenüber Proben von Human.

Kurzübersicht für CEP55 Antikörper (N-Term) (ABIN630721)

Target: CEP55 (Centrosomal Protein 55kDa (CEP55))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CEP55 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CEP55 Antikörper

Bindungsspezifität: N-Term

Spezifität: CEP55 antibody was raised against the N terminal of CEP55

Aufreinigung: Affinity purified

Immunogen: CEP55 antibody was raised using the N terminal of CEP55 corresponding to a region with amino acids MSSRSTKDLIKSKWGSKPSNSKSETTLEKLKGEIAHLKTSVDEITSGKGK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CEP55 Blocking Peptide, (ABIN5612824), is also available for use as a blocking control in assays to test for specificity of this CEP55 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CEP55 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CEP55

Target: CEP55 (Centrosomal Protein 55kDa (CEP55))

Andere Bezeichnung: CEP55

Hintergrund: CEP55 plays a role in mitotic exit and cytokinesis. Not required for microtubule nucleation.

Molekulargewicht: 54 kDa (MW of target protein)