PINX1 Antikörper (N-Term)
-
- Target Alle PINX1 Antikörper anzeigen
- PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PINX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PINX1 antibody was raised against the N terminal of PINX1
- Aufreinigung
- Affinity purified
- Immunogen
- PINX1 antibody was raised using the N terminal of PINX1 corresponding to a region with amino acids EKMGWSKGKGLGAQEQGATDHIKVQVKNNHLGLGATINNEDNWIAHQDDF
- Top Product
- Discover our top product PINX1 Primärantikörper
-
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 1-100) antibody
PINX1 Reaktivität: Human WB, ELISA Wirt: Maus Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (Internal Region) antibodyPINX1 Reaktivität: Human, Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 151-299) antibodyPINX1 Reaktivität: Human WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 85-133) antibodyPINX1 Reaktivität: Human, Maus, Ratte WB, IF (p), IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 127-328) antibodyPINX1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 225-237) antibodyVerified PINX1 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (N-Term) antibodyVerified PINX1 Reaktivität: Human WB, ELISA Wirt: Ziege Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 35-84) antibodyPINX1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Pferd, Kaninchen, Meerschweinchen, Affe, Fledermaus, Hamster WB Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 107-156) antibodyPINX1 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Schwein, Pferd, Kaninchen, Affe, Zebrafisch (Danio rerio) WB Wirt: Kaninchen Polyclonal unconjugated
anti-PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1) (AA 1-221) antibodyPINX1 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PINX1 Blocking Peptide, catalog no. 33R-2516, is also available for use as a blocking control in assays to test for specificity of this PINX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PINX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PINX1 (PIN2/TERF1 Interacting, Telomerase Inhibitor 1 (PINX1))
- Andere Bezeichnung
- PINX1 (PINX1 Produkte)
- Synonyme
- PINX1 antikoerper, LPTL antikoerper, LPTS antikoerper, 2210403I16Rik antikoerper, 2610028A01Rik antikoerper, 67-11-3 antikoerper, AU024023 antikoerper, LPTS1 antikoerper, RGD1566025 antikoerper, PIN2/TERF1 interacting telomerase inhibitor 1 antikoerper, PIN2/TERF1 interacting, telomerase inhibitor 1 antikoerper, PINX1 antikoerper, Pinx1 antikoerper
- Hintergrund
- PINX1 is a microtubule-binding protein essential for faithful chromosome segregation. PINX1 mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres.
- Molekulargewicht
- 37 kDa (MW of target protein)
-
