ZNF19 Antikörper (N-Term)
-
- Target Alle ZNF19 Antikörper anzeigen
- ZNF19 (Zinc Finger Protein 19 (ZNF19))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ZNF19 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ZNF19 antibody was raised against the N terminal of ZNF19
- Aufreinigung
- Affinity purified
- Immunogen
- ZNF19 antibody was raised using the N terminal of ZNF19 corresponding to a region with amino acids TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
- Top Product
- Discover our top product ZNF19 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ZNF19 Blocking Peptide, catalog no. 33R-8978, is also available for use as a blocking control in assays to test for specificity of this ZNF19 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF19 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZNF19 (Zinc Finger Protein 19 (ZNF19))
- Andere Bezeichnung
- ZNF19 (ZNF19 Produkte)
- Synonyme
- KOX12 antikoerper, zinc finger protein 19 antikoerper, ZNF19 antikoerper
- Hintergrund
- ZNF19 contains a zinc finger, a nucleic acid-binding domain present in many transcription factors.
- Molekulargewicht
- 52 kDa (MW of target protein)
-