MKRN2 Antikörper (C-Term)

Produktnummer ABIN630704

Der Kaninchen Polyklonal Anti-MKRN2-Antikörper wurde für WB validiert. Er ist geeignet, MKRN2 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MKRN2 Antikörper (C-Term) (ABIN630704)

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MKRN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MKRN2 Antikörper

Bindungsspezifität: C-Term

Spezifität: MKRN2 antibody was raised against the C terminal of MKRN2

Aufreinigung: Affinity purified

Immunogen: MKRN2 antibody was raised using the C terminal of MKRN2 corresponding to a region with amino acids ACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRKQLSSQGTVRFFNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MKRN2 Blocking Peptide, (ABIN936457), is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MKRN2

Target: MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Andere Bezeichnung: MKRN2

Hintergrund: Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

Molekulargewicht: 47 kDa (MW of target protein)