Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

MKRN2 Antikörper (N-Term)

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MKRN2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.
Produktnummer ABIN630703

Kurzübersicht für MKRN2 Antikörper (N-Term) (ABIN630703)

Target

Alle MKRN2 Antikörper anzeigen
MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

Reaktivität

  • 51
  • 24
  • 23
  • 5
  • 5
  • 4
  • 4
  • 4
  • 3
  • 2
  • 2
  • 1
Human, Maus, Ratte

Wirt

  • 45
  • 6
Kaninchen

Klonalität

  • 47
  • 4
Polyklonal

Konjugat

  • 28
  • 4
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Dieser MKRN2 Antikörper ist unkonjugiert

Applikation

  • 46
  • 16
  • 13
  • 7
  • 5
  • 5
  • 3
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 8
    • 7
    • 5
    • 4
    • 4
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    MKRN2 antibody was raised against the N terminal of MKRN2

    Aufreinigung

    Affinity purified

    Immunogen

    MKRN2 antibody was raised using the N terminal of MKRN2 corresponding to a region with amino acids STKQITCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRC
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    MKRN2 Blocking Peptide, (ABIN5614785), is also available for use as a blocking control in assays to test for specificity of this MKRN2 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MKRN2 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    MKRN2 (Makorin Ring Finger Protein 2 (MKRN2))

    Andere Bezeichnung

    MKRN2

    Hintergrund

    Members of the makorin family, including MKRN2, have a characteristic zinc finger composition that suggests that they are ribonucleoproteins.

    Molekulargewicht

    47 kDa (MW of target protein)
Sie sind hier:
Chat with us!