FBXL3 Antikörper (Middle Region)

Produktnummer ABIN630702

Produktdetails anti-FBXL3 Antikörper

Target: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXL3 antibody was raised against the middle region of FBXL3

Aufreinigung: Affinity purified

Immunogen: FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXL3

Target: FBXL3 (F-Box and Leucine-Rich Repeat Protein 3 (FBXL3))

Andere Bezeichnung: FBXL3 (FBXL3 Produkte)

Synonyme: FBL3 antikoerper, FBL3A antikoerper, FBXL3A antikoerper, AU041772 antikoerper, AW212966 antikoerper, FBK antikoerper, Fbl3a antikoerper, Fbxl3a antikoerper, Ovtm antikoerper, Play68 antikoerper, fbxl3 antikoerper, FBXL3 antikoerper, F7A7.240 antikoerper, F7A7_240 antikoerper, im:7153024 antikoerper, zgc:103721 antikoerper, F-box and leucine rich repeat protein 3 antikoerper, F-box and leucine-rich repeat protein 3 antikoerper, F-box and leucine-rich repeat protein 3 L homeolog antikoerper, RNI-like superfamily protein antikoerper, F-box and leucine-rich repeat protein 3a antikoerper, FBXL3 antikoerper, Fbxl3 antikoerper, fbxl3.L antikoerper, fbxl3 antikoerper, AT5G01720 antikoerper, fbxl3a antikoerper

Hintergrund: FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Molekulargewicht: 47 kDa (MW of target protein)

Pathways: Photoperiodism