HERC4 Antikörper (N-Term)

Produktnummer ABIN630701

Der Kaninchen Polyklonal Anti-HERC4-Antikörper wurde für WB validiert. Er ist geeignet, HERC4 in Proben von Human und Ratte zu detektieren.

Kurzübersicht für HERC4 Antikörper (N-Term) (ABIN630701)

Target: HERC4 (Hect Domain and RLD 4 (HERC4))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HERC4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HERC4 Antikörper

Bindungsspezifität: N-Term

Spezifität: HERC4 antibody was raised against the n terminal of HERC4

Aufreinigung: Affinity purified

Immunogen: HERC4 antibody was raised using the N terminal of HERC4 corresponding to a region with amino acids MLCWGNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HERC4 Blocking Peptide, (ABIN5613989), is also available for use as a blocking control in assays to test for specificity of this HERC4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HERC4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HERC4

Target: HERC4 (Hect Domain and RLD 4 (HERC4))

Andere Bezeichnung: HERC4

Hintergrund: HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins.

Molekulargewicht: 13 kDa (MW of target protein)