RBBP7 Antikörper (N-Term)

Produktnummer ABIN630697

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch RBBP7 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für RBBP7 Antikörper (N-Term) (ABIN630697)

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBBP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RBBP7 Antikörper

Bindungsspezifität: N-Term

Spezifität: RBBP7 antibody was raised against the N terminal of RBBP7

Aufreinigung: Affinity purified

Immunogen: RBBP7 antibody was raised using the N terminal of RBBP7 corresponding to a region with amino acids MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBBP7 Blocking Peptide, (ABIN5615777), is also available for use as a blocking control in assays to test for specificity of this RBBP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBBP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBBP7

Target: RBBP7 (Retinoblastoma Binding Protein 7 (RBBP7))

Andere Bezeichnung: RBBP7

Hintergrund: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation.

Molekulargewicht: 48 kDa (MW of target protein)