LOC642097 Antikörper (N-Term)

Produktnummer ABIN630692

Der Kaninchen Polyklonal Anti-LOC642097-Antikörper wurde für WB validiert. Er ist geeignet, LOC642097 in Proben von Human zu detektieren.

Kurzübersicht für LOC642097 Antikörper (N-Term) (ABIN630692)

Target: LOC642097

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails anti-LOC642097 Antikörper

Bindungsspezifität: N-Term

Spezifität: LOC642097 antibody was raised against the N terminal Of Loc642097

Aufreinigung: Affinity purified

Immunogen: LOC642097 antibody was raised using the N terminal Of Loc642097 corresponding to a region with amino acids MSDAHLGEAVDDIVSALKLGPGTVVPELRSLKPEAQALITQGLYSHCRAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LOC642097 Blocking Peptide, (ABIN5614524), is also available for use as a blocking control in assays to test for specificity of this LOC642097 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC642097 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LOC642097

Target: LOC642097

Andere Bezeichnung: LOC642097

Hintergrund: The function of LOC642097 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 37 kDa (MW of target protein)