Actl7b Antikörper (Middle Region)

Produktnummer ABIN630675

Der Kaninchen Polyklonal anti-Actl7b Antikörper (ABIN630675) detektiert spezifisch Actl7b in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für Actl7b Antikörper (Middle Region) (ABIN630675)

Target: Actl7b (Actin-Like 7b (Actl7b))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Actl7b Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Actl7b Antikörper

Bindungsspezifität: Middle Region

Spezifität: ACTL7 B antibody was raised against the middle region of ACTL7

Aufreinigung: Affinity purified

Immunogen: ACTL7 B antibody was raised using the middle region of ACTL7 corresponding to a region with amino acids KLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTL7B Blocking Peptide, (ABIN939897), is also available for use as a blocking control in assays to test for specificity of this ACTL7B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Actl7b

Target: Actl7b (Actin-Like 7b (Actl7b))

Andere Bezeichnung: ACTL7B

Hintergrund: ACTL7B is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Molekulargewicht: 46 kDa (MW of target protein)