Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

PIM1 Antikörper (N-Term)

Der Kaninchen Polyklonal Anti-PIM1-Antikörper wurde für WB validiert. Er ist geeignet, PIM1 in Proben von Human, Maus und Ratte zu detektieren.
Produktnummer ABIN630674

Kurzübersicht für PIM1 Antikörper (N-Term) (ABIN630674)

Target

Alle PIM1 Antikörper anzeigen
PIM1 (Pim-1 Oncogene (PIM1))

Reaktivität

  • 108
  • 52
  • 50
  • 4
  • 4
  • 3
  • 3
  • 3
  • 2
  • 2
  • 2
  • 1
  • 1
  • 1
Human, Maus, Ratte

Wirt

  • 103
  • 17
Kaninchen

Klonalität

  • 94
  • 26
Polyklonal

Konjugat

  • 54
  • 15
  • 6
  • 5
  • 3
  • 3
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
  • 2
Dieser PIM1 Antikörper ist unkonjugiert

Applikation

  • 96
  • 41
  • 39
  • 26
  • 26
  • 21
  • 17
  • 16
  • 14
  • 11
  • 6
  • 4
  • 2
  • 1
  • 1
Western Blotting (WB)
  • Bindungsspezifität

    • 22
    • 16
    • 8
    • 8
    • 7
    • 7
    • 6
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term

    Spezifität

    PIM1 antibody was raised against the N terminal of PIM1

    Aufreinigung

    Affinity purified

    Immunogen

    PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
  • Applikationshinweise

    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.

    Kommentare

    PIM1 Blocking Peptide, (ABIN5615379), is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody

    Beschränkungen

    Nur für Forschungszwecke einsetzbar
  • Format

    Lyophilized

    Rekonstitution

    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS

    Konzentration

    Lot specific

    Buffer

    PBS

    Handhabung

    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.

    Lagerung

    4 °C/-20 °C

    Informationen zur Lagerung

    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target

    PIM1 (Pim-1 Oncogene (PIM1))

    Andere Bezeichnung

    PIM1

    Hintergrund

    PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.

    Molekulargewicht

    36 kDa (MW of target protein)

    Pathways

    Glycosaminoglycan Metabolic Process
Sie sind hier:
Chat with us!