PIM1 Antikörper (N-Term)
Kurzübersicht für PIM1 Antikörper (N-Term) (ABIN630674)
Target
Alle PIM1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- N-Term
-
Spezifität
- PIM1 antibody was raised against the N terminal of PIM1
-
Aufreinigung
- Affinity purified
-
Immunogen
- PIM1 antibody was raised using the N terminal of PIM1 corresponding to a region with amino acids MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG
-
-
-
-
Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
PIM1 Blocking Peptide, (ABIN5615379), is also available for use as a blocking control in assays to test for specificity of this PIM1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIM1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- PIM1 (Pim-1 Oncogene (PIM1))
-
Andere Bezeichnung
- PIM1
-
Hintergrund
- PIM1 may affect the structure or silencing of chromatin by phosphorylating HP1 gamma/CBX3. Isoform 2 promotes the G1/S transition of the cell cycle via up-regulation of CDK2 activity and phosphorylation of CDKN1B.
-
Molekulargewicht
- 36 kDa (MW of target protein)
-
Pathways
- Glycosaminoglycan Metabolic Process
Target
-