MSL2 Antikörper

Produktnummer ABIN630673

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MSL2 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für MSL2 Antikörper (ABIN630673)

Target: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MSL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: MSL2 L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MSL2L1 Blocking Peptide, (ABIN5614854), is also available for use as a blocking control in assays to test for specificity of this MSL2L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSL0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MSL2

Target: MSL2 (Male-Specific Lethal 2 Homolog (MSL2))

Andere Bezeichnung: MSL2L1

Hintergrund: MSL2L1 is the component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.

Molekulargewicht: 62 kDa (MW of target protein)