CDYL Antikörper (N-Term)
-
- Target Alle CDYL Antikörper anzeigen
- CDYL (Chromodomain Protein, Y-Like (CDYL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDYL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CDYL antibody was raised against the n terminal of CDYL
- Aufreinigung
- Affinity purified
- Immunogen
- CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
- Top Product
- Discover our top product CDYL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CDYL Blocking Peptide, catalog no. 33R-10137, is also available for use as a blocking control in assays to test for specificity of this CDYL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDYL (Chromodomain Protein, Y-Like (CDYL))
- Andere Bezeichnung
- CDYL (CDYL Produkte)
- Synonyme
- AI325931 antikoerper, CDYL1 antikoerper, chromodomain Y like antikoerper, chromodomain protein, Y chromosome-like antikoerper, chromodomain Y-like antikoerper, CDYL antikoerper, Cdyl antikoerper
- Hintergrund
- CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.
- Molekulargewicht
- 60 kDa (MW of target protein)
-