CDYL Antikörper (N-Term)

Produktnummer ABIN630672

Produktdetails anti-CDYL Antikörper

Target: CDYL (Chromodomain Protein, Y-Like (CDYL))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDYL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CDYL antibody was raised against the n terminal of CDYL

Aufreinigung: Affinity purified

Immunogen: CDYL antibody was raised using the N terminal of CDYL corresponding to a region with amino acids YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDYL Blocking Peptide, catalog no. 33R-10137, is also available for use as a blocking control in assays to test for specificity of this CDYL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDYL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDYL

Target: CDYL (Chromodomain Protein, Y-Like (CDYL))

Andere Bezeichnung: CDYL (CDYL Produkte)

Hintergrund: CDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene.

Molekulargewicht: 60 kDa (MW of target protein)