ING3 Antikörper (N-Term)

Produktnummer ABIN630670

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch ING3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für ING3 Antikörper (N-Term) (ABIN630670)

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ING3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ING3 Antikörper

Bindungsspezifität: N-Term

Spezifität: ING3 antibody was raised against the N terminal of ING3

Aufreinigung: Affinity purified

Immunogen: ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ING3 Blocking Peptide, (ABIN5614195), is also available for use as a blocking control in assays to test for specificity of this ING3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ING3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ING3

Target: ING3 (Inhibitor of Growth Family, Member 3 (ING3))

Andere Bezeichnung: ING3

Hintergrund: ING3 is similar to ING1, a tumor suppressor protein that can interact with TP53, inhibit cell growth, and induce apoptosis. This protein contains a PHD-finger, which is a common motif in proteins involved in chromatin remodeling. This gene can activate p53 trans-activated promoters, including promoters of p21/waf1 and bax. Overexpression of this gene has been shown to inhibit cell growth and induce apoptosis. Allelic loss and reduced expression of this gene were detected in head and neck cancers.

Molekulargewicht: 47 kDa (MW of target protein)