KPNA5 Antikörper

Produktnummer ABIN630665

Der Kaninchen Polyklonal Anti-KPNA5-Antikörper wurde für WB validiert. Er ist geeignet, KPNA5 in Proben von Human zu detektieren.

Kurzübersicht für KPNA5 Antikörper (ABIN630665)

Target: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KPNA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KPNA5 Antikörper

Aufreinigung: Affinity purified

Immunogen: Karyopherin Alpha 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVMDSKIVQVALNGLENILRLGEQESKQNGIGINPYCALIEEAYGLDKIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Karyopherin Alpha 5 Blocking Peptide, (ABIN5614254), is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KPNA5

Target: KPNA5 (Karyopherin alpha 5 (Importin alpha 6) (KPNA5))

Andere Bezeichnung: Karyopherin alpha 5

Hintergrund: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA5 protein belongs to the importin alpha protein family and is thought to be involved in NLS-dependent protein import into the nucleus.

Molekulargewicht: 61 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus