CK1 delta (Middle Region) Antikörper

Produktnummer ABIN630662

Produktdetails

Target: CK1 delta

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CK1 delta antibody was raised against the middle region of CSNK1 D

Aufreinigung: Affinity purified

Immunogen: CK1 delta antibody was raised using the middle region of CSNK1 D corresponding to a region with amino acids NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASINTHLGIEQSR

Anwendungsinformationen

Applikationshinweise: WB: 0.2-1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CK1 delta Blocking Peptide, catalog no. 33R-6786, is also available for use as a blocking control in assays to test for specificity of this CK1 delta antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSNK0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: CK1 delta

Hintergrund: This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair.

Molekulargewicht: 47 kDa (MW of target protein)