MAP3K15 Antikörper (Middle Region)

Produktnummer ABIN630660

Produktdetails anti-MAP3K15 Antikörper

Target: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAP3K15 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAP3 K15 antibody was raised against the middle region of MAP3 15

Aufreinigung: Affinity purified

Immunogen: MAP3 K15 antibody was raised using the middle region of MAP3 15 corresponding to a region with amino acids TLEQKTQELYHLQLKLKSNCITENPAGPYGQRTDKELIDWLRLQGADAKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAP3K15 Blocking Peptide, catalog no. 33R-9170, is also available for use as a blocking control in assays to test for specificity of this MAP3K15 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 15 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAP3K15

Target: MAP3K15 (Mitogen-Activated Protein Kinase Kinase Kinase 15 (MAP3K15))

Andere Bezeichnung: MAP3K15 (MAP3K15 Produkte)

Synonyme: MCO15.4 antikoerper, MCO15_4 antikoerper, mitogen-activated protein kinase kinase kinase 15 antikoerper, ASK3 antikoerper, bA723P2.3 antikoerper, BC031147 antikoerper, MEKK15 antikoerper, mitogen-activated protein kinase kinase kinase 15 antikoerper, MAPKKK15 antikoerper, MAP3K15 antikoerper, Map3k15 antikoerper

Hintergrund: MAP3K15 is a component of a protein kinase signal transduction cascade.

Molekulargewicht: 89 kDa (MW of target protein)