TSSK2 Antikörper (Middle Region)

Produktnummer ABIN630656

Der Kaninchen Polyklonal anti-TSSK2 Antikörper wird verwendet zum Nachweis von TSSK2 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für TSSK2 Antikörper (Middle Region) (ABIN630656)

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSSK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TSSK2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TSSK2 antibody was raised against the middle region of TSSK2

Aufreinigung: Affinity purified

Immunogen: TSSK2 antibody was raised using the middle region of TSSK2 corresponding to a region with amino acids RMLQPDVSQRLHIDEILSHSWLQPPKPKATSSASFKREGEGKYRAECKLD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSSK2 Blocking Peptide, (ABIN5616832), is also available for use as a blocking control in assays to test for specificity of this TSSK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSSK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSSK2

Target: TSSK2 (Testis-Specific serine Kinase 2 (TSSK2))

Andere Bezeichnung: TSSK2

Hintergrund: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis.

Molekulargewicht: 39 kDa (MW of target protein)