LPP Antikörper (N-Term)

Produktnummer ABIN630655

Produktdetails anti-LPP Antikörper

Target: LPP (Lipoma-preferred partner (LPP))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LPP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LPP antibody was raised against the N terminal of LPP

Aufreinigung: Affinity purified

Immunogen: LPP antibody was raised using the N terminal of LPP corresponding to a region with amino acids GKTLEERRSSLDAEIDSLTSILADLECSSPYKPRPPQSSTGSTASPPVST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LPP Blocking Peptide, catalog no. 33R-3379, is also available for use as a blocking control in assays to test for specificity of this LPP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LPP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LPP

Target: LPP (Lipoma-preferred partner (LPP))

Andere Bezeichnung: LPP (LPP Produkte)

Synonyme: 9430020K16Rik antikoerper, AA959454 antikoerper, AU024130 antikoerper, B130055L10Rik antikoerper, C79715 antikoerper, D630048H16 antikoerper, LIM domain containing preferred translocation partner in lipoma antikoerper, LPP antikoerper, Lpp antikoerper

Hintergrund: LPP may play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. LPP may be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. LPP is also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus.

Molekulargewicht: 67 kDa (MW of target protein)