SLA Antikörper (Middle Region)

Produktnummer ABIN630654

Produktdetails anti-SLA Antikörper

Target: SLA (Src-Like-Adaptor (SLA))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLA1 antibody was raised against the middle region of SLA

Aufreinigung: Affinity purified

Immunogen: SLA1 antibody was raised using the middle region of SLA corresponding to a region with amino acids PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLA1 Blocking Peptide, catalog no. 33R-7045, is also available for use as a blocking control in assays to test for specificity of this SLA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLA

Target: SLA (Src-Like-Adaptor (SLA))

Andere Bezeichnung: SLA1 (SLA Produkte)

Synonyme: SLA1 antikoerper, SLAP antikoerper, src-like-adapter antikoerper, SLA antikoerper, Slap1 antikoerper, Slap antikoerper, Slap-1 antikoerper, Src like adaptor antikoerper, Src-like-adaptor antikoerper, src-like adaptor antikoerper, SLA antikoerper, Sla antikoerper

Hintergrund: SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells.

Molekulargewicht: 31 kDa (MW of target protein)