ACTR1B Antikörper
-
- Target Alle ACTR1B Antikörper anzeigen
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTR1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ACTR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids KIKISAPQERLYSTWIGGSILASLDTFKKMWVSKKEYEEDGSRAIHRKTF
- Top Product
- Discover our top product ACTR1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTR1B Blocking Peptide, catalog no. 33R-4434, is also available for use as a blocking control in assays to test for specificity of this ACTR1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTR1B (ARP1 Actin-Related Protein 1 Homolog B, Centractin beta (ACTR1B))
- Andere Bezeichnung
- ACTR1B (ACTR1B Produkte)
- Synonyme
- ARP1B antikoerper, CTRN2 antikoerper, PC3 antikoerper, 2310066K23Rik antikoerper, AA960180 antikoerper, AI851923 antikoerper, Arp1b antikoerper, ACTR1B antikoerper, ARP1 actin related protein 1 homolog B antikoerper, ARP1 actin-related protein 1B, centractin beta antikoerper, ARP1 actin-related protein 1 homolog B antikoerper, ARP1 actin-related protein 1 homolog B, centractin beta (yeast) antikoerper, beta-centractin antikoerper, ACTR1B antikoerper, Actr1b antikoerper, LOC100594459 antikoerper
- Hintergrund
- ACTR1B is a 42.3 kDa subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kDa. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis.
- Molekulargewicht
- 42 kDa (MW of target protein)
-