PPAT Antikörper (N-Term)

Produktnummer ABIN630652

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PPAT in WB und IHC. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für PPAT Antikörper (N-Term) (ABIN630652)

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PPAT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PPAT Antikörper

Bindungsspezifität: N-Term

Spezifität: PPAT antibody was raised against the N terminal of PPAT

Aufreinigung: Affinity purified

Immunogen: PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PPAT Blocking Peptide, (ABIN5615489), is also available for use as a blocking control in assays to test for specificity of this PPAT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PPAT

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Andere Bezeichnung: PPAT

Hintergrund: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Molekulargewicht: 56 kDa (MW of target protein)