CHFR Antikörper (N-Term)
-
- Target Alle CHFR Antikörper anzeigen
- CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHFR Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHFR antibody was raised against the N terminal of CHFR
- Aufreinigung
- Affinity purified
- Immunogen
- CHFR antibody was raised using the N terminal of CHFR corresponding to a region with amino acids REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN
- Top Product
- Discover our top product CHFR Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHFR Blocking Peptide, catalog no. 33R-7895, is also available for use as a blocking control in assays to test for specificity of this CHFR antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHFR antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))
- Andere Bezeichnung
- CHFR (CHFR Produkte)
- Synonyme
- RNF116 antikoerper, RNF196 antikoerper, CHFR antikoerper, fc43f10 antikoerper, si:dkey-69h6.7 antikoerper, wu:fc43f10 antikoerper, rnf116 antikoerper, rnf196 antikoerper, 5730484M20Rik antikoerper, C230082M18 antikoerper, checkpoint with forkhead and ring finger domains antikoerper, checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase antikoerper, checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase L homeolog antikoerper, CHFR antikoerper, chfr antikoerper, Chfr antikoerper, chfr.L antikoerper
- Hintergrund
- CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.
- Molekulargewicht
- 69 kDa (MW of target protein)
-