CHFR Antikörper (N-Term)

Produktnummer ABIN630645

Dieses Anti-CHFR-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CHFR in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für CHFR Antikörper (N-Term) (ABIN630645)

Target: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHFR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHFR Antikörper

Bindungsspezifität: N-Term

Spezifität: CHFR antibody was raised against the N terminal of CHFR

Aufreinigung: Affinity purified

Immunogen: CHFR antibody was raised using the N terminal of CHFR corresponding to a region with amino acids REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHFR Blocking Peptide, (ABIN5612847), is also available for use as a blocking control in assays to test for specificity of this CHFR antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHFR antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHFR

Target: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Andere Bezeichnung: CHFR

Hintergrund: CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.

Molekulargewicht: 69 kDa (MW of target protein)